Lineage for d1zgqc_ (1zgq C:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199112Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1199113Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1199114Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1199312Protein automated matches [190406] (14 species)
    not a true protein
  7. 1199351Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries)
  8. 1199382Domain d1zgqc_: 1zgq C: [162466]
    automated match to d1g7ka_
    complexed with peg

Details for d1zgqc_

PDB Entry: 1zgq (more details), 1.9 Å

PDB Description: Crystal Structure of the Discosoma Red Fluorescent Protein (DsRed) Variant Q66M
PDB Compounds: (C:) red fluorescent protein drfp583

SCOPe Domain Sequences for d1zgqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgqc_ d.22.1.1 (C:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
mygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi
gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk
pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d1zgqc_:

Click to download the PDB-style file with coordinates for d1zgqc_.
(The format of our PDB-style files is described here.)

Timeline for d1zgqc_: