SCOPe 2.06: Domain d1zgpc_: 1zgp C:

Lineage for d1zgpc_ (1zgp C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries)

8. Domain d1zgpc_: 1zgp C: [162462]
   automated match to d1g7ka_

Details for d1zgpc_

PDB Entry: 1zgp, 1.9 Å

PDB Description: crystal structure of the discosoma red fluorescent protein (dsred) variant k70m

PDB Compounds: (C:) red fluorescent protein drfp583

SCOPe Domain Sequences for d1zgpc_:

Sequence; same for both SEQRES and ATOM records:

>d1zgpc_ d.22.1.1 (C:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
qygsmvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi
gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk
pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl

Timeline for d1zgpc_:

• d1zgpc_ first appeared in SCOPe 2.01
  
• d1zgpc_ appears in SCOPe 2.05
  
• d1zgpc_ appears in SCOPe 2.07
  
• d1zgpc_ appears in the current release, SCOPe 2.08