Lineage for d1aci__ (1aci -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1710Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1711Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1712Protein Ribosomal protein L11, C-terminal domain [46908] (2 species)
  7. 1713Species Bacillus stearothermophilus [TaxId:1422] [46909] (6 PDB entries)
  8. 1720Domain d1aci__: 1aci - [16246]

Details for d1aci__

PDB Entry: 1aci (more details)

PDB Description: l11 ribosomal protein rna binding domain, nmr, 20 structures
PDB Compounds: ( :)

SCOP Domain Sequences for d1aci__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aci__ a.4.7.1 (-) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved

SCOP Domain Coordinates for d1aci__:

Click to download the PDB-style file with coordinates for d1aci__.
(The format of our PDB-style files is described here.)

Timeline for d1aci__: