Lineage for d1zgod_ (1zgo D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184480Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2184481Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2184482Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2184772Protein automated matches [190406] (19 species)
    not a true protein
  7. 2184845Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries)
  8. 2184857Domain d1zgod_: 1zgo D: [162459]
    automated match to d1g7ka_

Details for d1zgod_

PDB Entry: 1zgo (more details), 1.4 Å

PDB Description: High Resolution Crystal Structure of the Discosoma Red Fluorescent Protein (DsRed)
PDB Compounds: (D:) red fluorescent protein drfp583

SCOPe Domain Sequences for d1zgod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgod_ d.22.1.1 (D:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nvikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqf
qygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfi
gvnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakk
pvqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d1zgod_:

Click to download the PDB-style file with coordinates for d1zgod_.
(The format of our PDB-style files is described here.)

Timeline for d1zgod_: