Lineage for d1zfnd_ (1zfn D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921020Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest
  4. 2921021Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) (S)
    transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins
    the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds
  5. 2921096Family c.111.1.0: automated matches [191511] (1 protein)
    not a true family
  6. 2921097Protein automated matches [190855] (2 species)
    not a true protein
  7. 2921101Species Escherichia coli [TaxId:562] [188186] (2 PDB entries)
  8. 2921105Domain d1zfnd_: 1zfn D: [162455]
    automated match to d1jw9b_
    complexed with atp, zn

Details for d1zfnd_

PDB Entry: 1zfn (more details), 2.75 Å

PDB Description: Structural Analysis of Escherichia coli ThiF
PDB Compounds: (D:) Adenylyltransferase thiF

SCOPe Domain Sequences for d1zfnd_:

Sequence, based on SEQRES records: (download)

>d1zfnd_ c.111.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep
erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc
pvcg

Sequence, based on observed residues (ATOM records): (download)

>d1zfnd_ c.111.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd
ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad
vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnagv
vgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgcpvcg

SCOPe Domain Coordinates for d1zfnd_:

Click to download the PDB-style file with coordinates for d1zfnd_.
(The format of our PDB-style files is described here.)

Timeline for d1zfnd_: