Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.111: Activating enzymes of the ubiquitin-like proteins [69571] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 32145678; strands 6 and 8 are antiparallel to the rest |
Superfamily c.111.1: Activating enzymes of the ubiquitin-like proteins [69572] (3 families) transfer adenylyl group to the C-terminal carboxyl group of the ubiquitin and MoaD/ThiS-related proteins the ATP nucleotide-binding site is similar to that of the NAD-binding Rossmann-folds |
Family c.111.1.0: automated matches [191511] (1 protein) not a true family |
Protein automated matches [190855] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [188186] (2 PDB entries) |
Domain d1zfna_: 1zfn A: [162452] automated match to d1jw9b_ complexed with atp, zn |
PDB Entry: 1zfn (more details), 2.75 Å
SCOPe Domain Sequences for d1zfna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zfna_ c.111.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mndrdfmrysrqillddialdgqqklldsqvliiglgglgtpaalylagagvgtlvladd ddvhlsnlqrqilfttedidrpksqvsqqrltqlnpdiqltalqqrltgealkdavarad vvldctdnmatrqeinaacvalntplitasavgfggqlmvltppweqgcyrclwpdnqep erncrtagvvgpvvgvmgtlqaleaikllsgietpagelrlfdgkssqwrslalrrasgc pvcg
Timeline for d1zfna_: