Lineage for d1foya_ (1foy A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763169Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 763170Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 763171Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 763212Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries)
  8. 763223Domain d1foya_: 1foy A: [16245]
    mutant

Details for d1foya_

PDB Entry: 1foy (more details)

PDB Description: the rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, minimized average structure
PDB Compounds: (A:) ribosomal protein l11

SCOP Domain Sequences for d1foya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1foya_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved

SCOP Domain Coordinates for d1foya_:

Click to download the PDB-style file with coordinates for d1foya_.
(The format of our PDB-style files is described here.)

Timeline for d1foya_: