SCOPe 2.04: Domain d1zckc_: 1zck C:

Lineage for d1zckc_ (1zck C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein Protein tyrosine phosphatase type IVa [102418] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188182] (1 PDB entry)

8. Domain d1zckc_: 1zck C: [162444]
   automated match to d1rxda_
   complexed with acy

Details for d1zckc_

PDB Entry: 1zck, 1.9 Å

PDB Description: native structure prl-1 (ptp4a1)

PDB Compounds: (C:) protein tyrosine phosphatase 4a1

SCOPe Domain Sequences for d1zckc_:

Sequence; same for both SEQRES and ATOM records:

>d1zckc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw
pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed
avqfirqkrrgafnskqllylekyrpkmrlrf

Timeline for d1zckc_:

• d1zckc_ first appeared in SCOPe 2.01
  
• d1zckc_ appears in SCOPe 2.03
  
• d1zckc_ appears in SCOPe 2.05
  
• d1zckc_ appears in the current release, SCOPe 2.08