Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein Protein tyrosine phosphatase type IVa [102418] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188182] (1 PDB entry) |
Domain d1zckc_: 1zck C: [162444] automated match to d1rxda_ complexed with acy |
PDB Entry: 1zck (more details), 1.9 Å
SCOPe Domain Sequences for d1zckc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zckc_ c.45.1.1 (C:) Protein tyrosine phosphatase type IVa {Norway rat (Rattus norvegicus) [TaxId: 10116]} pvevtyknmrflithnptnatlnkfieelkkygvttivrvceatydttlvekegihvldw pfddgappsnqivddwlslvkikfreepgcciavhcvaglgrapvlvalalieggmkyed avqfirqkrrgafnskqllylekyrpkmrlrf
Timeline for d1zckc_: