SCOPe 2.05: Domain d2fowa_: 2fow A:

Lineage for d2fowa_ (2fow A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries)

8. Domain d2fowa_: 2fow A: [16244]

Details for d2fowa_

PDB Entry: 2fow

PDB Description: the rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, 26 structures

PDB Compounds: (A:) ribosomal protein l11

SCOPe Domain Sequences for d2fowa_:

Sequence; same for both SEQRES and ATOM records:

>d2fowa_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved

Timeline for d2fowa_:

• d2fowa_ first appeared (with stable ids) in SCOP 1.55, called d2fow__
  
• d2fowa_ appears in SCOPe 2.04
  
• d2fowa_ appears in SCOPe 2.06
  
• d2fowa_ appears in the current release, SCOPe 2.08