Lineage for d2fowa_ (2fow A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695426Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries)
  8. 2695436Domain d2fowa_: 2fow A: [16244]

Details for d2fowa_

PDB Entry: 2fow (more details)

PDB Description: the rna binding domain of ribosomal protein l11: three-dimensional structure of the rna-bound form of the protein, nmr, 26 structures
PDB Compounds: (A:) ribosomal protein l11

SCOPe Domain Sequences for d2fowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fowa_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved

SCOPe Domain Coordinates for d2fowa_:

Click to download the PDB-style file with coordinates for d2fowa_.
(The format of our PDB-style files is described here.)

Timeline for d2fowa_: