Lineage for d1zb9a_ (1zb9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007847Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 3007875Protein Organic hydroperoxide resistance protein Ohr [82786] (3 species)
  7. 3007882Species Xylella fastidiosa [TaxId:160492] [188177] (2 PDB entries)
  8. 3007883Domain d1zb9a_: 1zb9 A: [162435]
    automated match to d1n2fa_
    complexed with pe4

Details for d1zb9a_

PDB Entry: 1zb9 (more details), 1.8 Å

PDB Description: crystal structure of xylella fastidiosa organic peroxide resistance protein
PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d1zb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zb9a_ d.227.1.1 (A:) Organic hydroperoxide resistance protein Ohr {Xylella fastidiosa [TaxId: 160492]}
nslekvlytaivtatggrdgsvvssdnvlnvklsvpqglggpggsgtnpeqlfaagysac
figalkfvankekvdlpaeprvegrvgigeipggfglvvelriavsgmersmlqtlvdka
hrvcpysnatrgnidvvlilid

SCOPe Domain Coordinates for d1zb9a_:

Click to download the PDB-style file with coordinates for d1zb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1zb9a_: