Lineage for d1fowa_ (1fow A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907458Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 907459Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 907460Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 907461Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries)
  8. 907469Domain d1fowa_: 1fow A: [16243]

Details for d1fowa_

PDB Entry: 1fow (more details)

PDB Description: nmr structure of l11-c76, the c-terminal domain of 50s ribosomal protein l11, minimized average structure
PDB Compounds: (A:) l11-c76

SCOPe Domain Sequences for d1fowa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fowa_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved

SCOPe Domain Coordinates for d1fowa_:

Click to download the PDB-style file with coordinates for d1fowa_.
(The format of our PDB-style files is described here.)

Timeline for d1fowa_: