Lineage for d1za7a_ (1za7 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966111Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 966284Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 966610Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 966658Protein automated matches [190852] (1 species)
    not a true protein
  7. 966659Species Cowpea chlorotic mottle virus [TaxId:12303] [188176] (1 PDB entry)
  8. 966660Domain d1za7a_: 1za7 A: [162428]
    automated match to d1cwpb_

Details for d1za7a_

PDB Entry: 1za7 (more details), 2.7 Å

PDB Description: the crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution.
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1za7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1za7a_ b.121.4.5 (A:) automated matches {Cowpea chlorotic mottle virus [TaxId: 12303]}
qgraikawtgysvskwtascaaaeakvtsaitislpnelssernkqlkvgrvllwlgllp
svsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgitleqlaadltiyly
ssaaltegdvivhlevehvrptfddsftpvy

SCOPe Domain Coordinates for d1za7a_:

Click to download the PDB-style file with coordinates for d1za7a_.
(The format of our PDB-style files is described here.)

Timeline for d1za7a_: