Lineage for d1z9zb1 (1z9z B:4-60)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2054180Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2054181Protein automated matches [190457] (10 species)
    not a true protein
  7. 2054186Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)
  8. 2054205Domain d1z9zb1: 1z9z B:4-60 [162427]
    Other proteins in same PDB: d1z9za2, d1z9zb2
    automated match to d1fyna_
    complexed with so4

Details for d1z9zb1

PDB Entry: 1z9z (more details), 1.95 Å

PDB Description: crystal structure of yeast sla1 sh3 domain 3
PDB Compounds: (B:) Cytoskeleton assembly control protein SLA1

SCOPe Domain Sequences for d1z9zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9zb1 b.34.2.0 (B:4-60) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rgivqydfmaesqdeltiksgdkvyilddkkskdwwmcqlvdsgksglvpaqfiepv

SCOPe Domain Coordinates for d1z9zb1:

Click to download the PDB-style file with coordinates for d1z9zb1.
(The format of our PDB-style files is described here.)

Timeline for d1z9zb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z9zb2