Lineage for d1z97a1 (1z97 A:4-261)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. Protein automated matches [190681] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187805] (56 PDB entries)
  8. Domain d1z97a1: 1z97 A:4-261 [162418]
    Other proteins in same PDB: d1z97a2
    automated match to d1flja_
    complexed with zn

Details for d1z97a1

PDB Entry: 1z97 (more details), 2.1 Å

PDB Description: Human Carbonic Anhydrase III: Structural and Kinetic Study of Catalysis and Proton Transfer.
PDB Compounds: (A:) Carbonic anhydrase III

SCOPe Domain Sequences for d1z97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z97a1 b.74.1.1 (A:4-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktilnng
ktcrvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlvhw
npkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdpssl
fpasrdywtyqgslttppceecivwlllkepmtvssdqmaklrsllssaeneppvplvsn
wrppqpinnrvvrasfk

SCOPe Domain Coordinates for d1z97a1 are not available.

Timeline for d1z97a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z97a2