Lineage for d1z95a_ (1z95 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009447Domain d1z95a_: 1z95 A: [162417]
    automated match to d1e3ga_
    complexed with 198, so4; mutant

Details for d1z95a_

PDB Entry: 1z95 (more details), 1.8 Å

PDB Description: Crystal Structure of the Androgen Receptor Ligand-binding Domain W741L Mutant Complex with R-bicalutamide
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d1z95a_:

Sequence, based on SEQRES records: (download)

>d1z95a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyslmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpts
csrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkv
kpiyfh

Sequence, based on observed residues (ATOM records): (download)

>d1z95a_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhvd
dqmaviqyslmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhls
qefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiacsrrfyql
tklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgkvkpiyfh

SCOPe Domain Coordinates for d1z95a_:

Click to download the PDB-style file with coordinates for d1z95a_.
(The format of our PDB-style files is described here.)

Timeline for d1z95a_: