Lineage for d1z8wc_ (1z8w C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497212Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2497213Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
    automatically mapped to Pfam PF01470
  6. 2497214Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 2497228Species Pyrococcus furiosus [TaxId:2261] [64099] (7 PDB entries)
  8. 2497235Domain d1z8wc_: 1z8w C: [162410]
    automated match to d1ioia_
    mutant

Details for d1z8wc_

PDB Entry: 1z8w (more details), 2 Å

PDB Description: structure of mutant pyrrolidone carboxyl peptidase (e192i) from a hyperthermophile, pyrococcus furiosus
PDB Compounds: (C:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d1z8wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8wc_ c.56.4.1 (C:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemileavkvaievaleell

SCOPe Domain Coordinates for d1z8wc_:

Click to download the PDB-style file with coordinates for d1z8wc_.
(The format of our PDB-style files is described here.)

Timeline for d1z8wc_: