Lineage for d1z8da_ (1z8d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142250Protein automated matches [190111] (3 species)
    not a true protein
  7. 2142260Species Human (Homo sapiens) [TaxId:9606] [186954] (4 PDB entries)
  8. 2142265Domain d1z8da_: 1z8d A: [162402]
    automated match to d1e1ya_
    complexed with ade, amp, glc

Details for d1z8da_

PDB Entry: 1z8d (more details), 2.3 Å

PDB Description: Crystal Structure of Human Muscle Glycogen Phosphorylase a with AMP and Glucose
PDB Compounds: (A:) Glycogen phosphorylase, muscle form

SCOPe Domain Sequences for d1z8da_:

Sequence, based on SEQRES records: (download)

>d1z8da_ c.87.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrd
hlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmee
leeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkisggwqmeeadd
wlrygnpwekarpeftlpvhfyghvehtsqgakwvdtqvvlampydtpvpgyrnnvvntm
rlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvva
atlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrilvdlermdw
dkawdvtvrtcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgd
vdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqn
ktngitprrwlvlcnpglaeviaerigedfisdldqlrkllsfvddeafirdvakvkqen
klkfaaylereykvhinpnslfdiqvkriheykrqllnclhvitlynrikrepnkffvpr
tvmiggkaapgyhmakmiirlvtaigdvvnhdpavgdrlrviflenyrvslaekvipaad
lseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdkl
dqrgynaqeyydripelrqvieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyedyi
kcqekvsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa

Sequence, based on observed residues (ATOM records): (download)

>d1z8da_ c.87.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rplsdqekrkqisvrgvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlv
grwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeelee
ieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkisggwqmeeaddwlr
ygnpwekarpeftlpvhfyghvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlw
sakapgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkssk
fgcrdpvrtnfdafpdkvaiqlndthpslaipelmrilvdlermdwdkawdvtvrtcayt
nhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveega
vkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlc
npglaeviaerigedfisdldqlrkllsfvddeafirdvakvkqenklkfaaylereykv
hinpnslfdiqvkriheykrqllnclhvitlynrikrepnkffvprtvmiggkaapgyhm
akmiirlvtaigdvvnhdpavgdrlrviflenyrvslaekvipaadlseqistagteasg
tgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdkldqrgynaqeyydri
pelrqvieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyedyikcqekvsalyknpr
ewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpa

SCOPe Domain Coordinates for d1z8da_:

Click to download the PDB-style file with coordinates for d1z8da_.
(The format of our PDB-style files is described here.)

Timeline for d1z8da_: