SCOPe 2.06: Domain d1z8ca_: 1z8c A:

Lineage for d1z8ca_ (1z8c A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)

8. Domain d1z8ca_: 1z8c A: [162400]
   automated match to d1lzqa_
   complexed with 0zs, so4; mutant

Details for d1z8ca_

PDB Entry: 1z8c, 2.2 Å

PDB Description: crystal structure of the complex of mutant hiv-1 protease (l63p, a71v, v82t, i84v) with a hydroxyethylamine peptidomimetic inhibitor boc- phe-psi[r-ch(oh)ch2nh]-phe-glu-phe-nh2

PDB Compounds: (A:) protease retropepsin

SCOPe Domain Sequences for d1z8ca_:

Sequence; same for both SEQRES and ATOM records:

>d1z8ca_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qipieicghkvigtvlvgptptnvigrnlltqigctlnf

Timeline for d1z8ca_:

• d1z8ca_ first appeared in SCOPe 2.01
  
• d1z8ca_ appears in SCOPe 2.05
  
• d1z8ca_ appears in SCOPe 2.07
  
• d1z8ca_ appears in the current release, SCOPe 2.08