SCOPe 2.05: Domain d1z83c_: 1z83 C:

Lineage for d1z83c_ (1z83 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187523] (7 PDB entries)

8. Domain d1z83c_: 1z83 C: [162399]
   automated match to d3adka_
   complexed with ap5, so4, zn

Details for d1z83c_

PDB Entry: 1z83, 1.9 Å

PDB Description: crystal structure of human ak1a in complex with ap5a

PDB Compounds: (C:) adenylate kinase 1

SCOPe Domain Sequences for d1z83c_:

Sequence; same for both SEQRES and ATOM records:

>d1z83c_ c.37.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smeeklkktniifvvggpgsgkgtqcekivqkygythlstgdllrsevssgsargkklse
imekgqlvpletvldmlrdamvakvntskgflidgyprevqqgeeferrigqptlllyvd
agpetmtqrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsv
dsvfsqvcthldall

Timeline for d1z83c_:

• d1z83c_ first appeared in SCOPe 2.01
  
• d1z83c_ appears in SCOPe 2.04
  
• d1z83c_ is called d1z83c1 in SCOPe 2.06
  
• d1z83c_ appears in the current release, SCOPe 2.08, called d1z83c1