| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein automated matches [190087] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187523] (7 PDB entries) |
| Domain d1z83b1: 1z83 B:1-194 [162398] Other proteins in same PDB: d1z83a2, d1z83b2, d1z83c2 automated match to d3adka_ complexed with ap5, so4, zn |
PDB Entry: 1z83 (more details), 1.9 Å
SCOPe Domain Sequences for d1z83b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z83b1 c.37.1.1 (B:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meeklkktniifvvggpgsgkgtqcekivqkygythlstgdllrsevssgsargkklsei
mekgqlvpletvldmlrdamvakvntskgflidgyprevqqgeeferrigqptlllyvda
gpetmtqrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsvd
svfsqvcthldall
Timeline for d1z83b1:
View in 3DDomains from other chains: (mouse over for more information) d1z83a1, d1z83a2, d1z83c1, d1z83c2 |