Lineage for d1z83b1 (1z83 B:1-194)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474437Protein automated matches [190087] (15 species)
    not a true protein
  7. 2474479Species Human (Homo sapiens) [TaxId:9606] [187523] (7 PDB entries)
  8. 2474488Domain d1z83b1: 1z83 B:1-194 [162398]
    Other proteins in same PDB: d1z83a2, d1z83b2, d1z83c2
    automated match to d3adka_
    complexed with ap5, so4, zn

Details for d1z83b1

PDB Entry: 1z83 (more details), 1.9 Å

PDB Description: crystal structure of human ak1a in complex with ap5a
PDB Compounds: (B:) adenylate kinase 1

SCOPe Domain Sequences for d1z83b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z83b1 c.37.1.1 (B:1-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meeklkktniifvvggpgsgkgtqcekivqkygythlstgdllrsevssgsargkklsei
mekgqlvpletvldmlrdamvakvntskgflidgyprevqqgeeferrigqptlllyvda
gpetmtqrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsvd
svfsqvcthldall

SCOPe Domain Coordinates for d1z83b1:

Click to download the PDB-style file with coordinates for d1z83b1.
(The format of our PDB-style files is described here.)

Timeline for d1z83b1: