![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein automated matches [190087] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187523] (6 PDB entries) |
![]() | Domain d1z83b_: 1z83 B: [162398] automated match to d3adka_ complexed with ap5, so4, zn |
PDB Entry: 1z83 (more details), 1.9 Å
SCOPe Domain Sequences for d1z83b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z83b_ c.37.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smeeklkktniifvvggpgsgkgtqcekivqkygythlstgdllrsevssgsargkklse imekgqlvpletvldmlrdamvakvntskgflidgyprevqqgeeferrigqptlllyvd agpetmtqrllkrgetsgrvddneetikkrletyykatepviafyekrgivrkvnaegsv dsvfsqvcthldall
Timeline for d1z83b_: