SCOPe 2.05: Domain d1z7ca_: 1z7c A:

Lineage for d1z7ca_ (1z7c A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein automated matches [190263] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187052] (10 PDB entries)

8. Domain d1z7ca_: 1z7c A: [162396]
   automated match to d1hwga_

Details for d1z7ca_

PDB Entry: 1z7c, 2 Å

PDB Description: crystal structure of human placental lactogen

PDB Compounds: (A:) Chorionic somatomammotropin hormone

SCOPe Domain Sequences for d1z7ca_:

Sequence, based on SEQRES records:

>d1z7ca_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtvplsrlfdhamlqahrahqlaidtyqefeetyipkdqkysflhdsqtsfcfsdsiptp
snmeetqqksnlellrislllieswlepvrflrsmfannlvydtsdsddyhllkdleegi
qtlmgrledgsrrtgqilkqtyskfdtnshnhdallknygllycfrkdmdkvetflrmvq
crsvegsc

Sequence, based on observed residues (ATOM records):

>d1z7ca_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtvplsrlfdhamlqahrahqlaidtyqefeetyipkdqkysflsfcfsdsiptsnlell
rislllieswlepvrflrsmfannlvydtsdsddyhllkdleegiqtlmgrleqilkqty
skfdtdallknygllycfrkdmdkvetflrmvqcrsvegsc

Timeline for d1z7ca_:

• d1z7ca_ first appeared in SCOPe 2.01
  
• d1z7ca_ appears in SCOPe 2.04
  
• d1z7ca_ appears in SCOPe 2.06
  
• d1z7ca_ appears in the current release, SCOPe 2.08