| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (8 PDB entries) |
| Domain d1z76b_: 1z76 B: [162395] automated match to d1u73a_ complexed with pbp |
PDB Entry: 1z76 (more details), 1.85 Å
SCOPe Domain Sequences for d1z76b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z76b_ a.133.1.2 (B:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc
Timeline for d1z76b_: