Lineage for d1z69d_ (1z69 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839499Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2839562Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2839563Protein automated matches [190849] (11 species)
    not a true protein
  7. 2839591Species Methanosarcina barkeri [TaxId:2208] [188169] (1 PDB entry)
  8. 2839595Domain d1z69d_: 1z69 D: [162393]
    automated match to d1f07a_
    complexed with 1pg, cl, f42

Details for d1z69d_

PDB Entry: 1z69 (more details), 2.61 Å

PDB Description: Crystal structure of methylenetetrahydromethanopterin reductase (Mer) in complex with coenzyme F420
PDB Compounds: (D:) Coenzyme F420-dependent N(5),N(10)-methylenetetrahydromethanopterin reductase

SCOPe Domain Sequences for d1z69d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z69d_ c.1.16.0 (D:) automated matches {Methanosarcina barkeri [TaxId: 2208]}
mkfgiefvpsdpalkiayyaklseqqgfdhvwitdhynnrdvystltvlalntnsikigp
gvtnsytrnpaitassiasiaeisggravlglgpgdkatfdamgiawkkplattkeaiqa
irdfisgkkvsmdgemikfagaklafkagnipiymgaqgpkmlelageiadgvlinashp
kdfevaveqikkgaekagrdpsevdvtayacfsidkdpvkavnaakvvvafivagspdlv
lerhgipveaksqigaaiakgdfgalmgglvtpqmieafsicgtpddcmkrikdleaigv
tqivagspigpakekaikligkeiiak

SCOPe Domain Coordinates for d1z69d_:

Click to download the PDB-style file with coordinates for d1z69d_.
(The format of our PDB-style files is described here.)

Timeline for d1z69d_: