Lineage for d1z4ua_ (1z4u A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. Protein automated matches [190260] (25 species)
    not a true protein
  7. Species Hepatitis C virus [TaxId:11103] [187048] (44 PDB entries)
  8. Domain d1z4ua_: 1z4u A: [162385]
    automated match to d1nb4a_
    protein/RNA complex; complexed with cl, gol, ph9, po4

Details for d1z4ua_

PDB Entry: 1z4u (more details), 2.8 Å

PDB Description: hepatitis c virus ns5b rna-dependent rna polymerase complex with inhibitor pha-00799585
PDB Compounds: (A:) hcv ns5b polymerase

SCOPe Domain Sequences for d1z4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4ua_ e.8.1.4 (A:) automated matches {Hepatitis C virus [TaxId: 11103]}
msmsytwtgalitpcaaeesklpinalsnsllrhhnlvysttsrsaslrqkkvtfdrlqv
lddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrslssravnhi
rsvwkdlledtdtpiqttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvv
stlpqavmgssygfqyspkqrveflvntwkakkcpmgfsydtrcfdstvtendirveesi
yqccdlapearqairslterlyvggpmtnskgqncgyrrcrasgvlttscgntltcylka
aaacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeyd
lelitscssnvsvahdasgkrvyyltrdptvplaraawetarhtpvnswlgniimyaptl
warmilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsysp
geinrvasclrklgvpplrvwrhrarsvrakllsqggraaicgkylfnwavrtklkltpi
paasrlllsgwfvagysggdiyhs

SCOPe Domain Coordinates for d1z4ua_ are not available.

Timeline for d1z4ua_: