Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (27 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [188168] (1 PDB entry) |
Domain d1z4af_: 1z4a F: [162382] automated match to d1vlga_ complexed with lfa |
PDB Entry: 1z4a (more details), 2.3 Å
SCOPe Domain Sequences for d1z4af_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z4af_ a.25.1.1 (F:) automated matches {Thermotoga maritima [TaxId: 243274]} mmvisekvrkalneqlnreiyssylylsmatyfdaegfkgfahwmkkqaqeelthamkfy eyiyerggrveleaiekppsnwngikdafeaalkheefvtqsiynilelaseekdhatvs flkwfvdeqveeedqvreildllekangqmsvifqldrylgqre
Timeline for d1z4af_: