| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.3: Spo0A [46903] (1 protein) elaborated with additional helices automatically mapped to Pfam PF08769 |
| Protein Spo0A [46904] (2 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [46905] (1 PDB entry) |
| Domain d1fc3b_: 1fc3 B: [16238] CASP4 |
PDB Entry: 1fc3 (more details), 2 Å
SCOPe Domain Sequences for d1fc3b_:
Sequence, based on SEQRES records: (download)
>d1fc3b_ a.4.6.3 (B:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
kpknldasitsiiheigvpahikgylylreaiamvyhdiellgsitkvlypdiakkyntt
asrverairhaievawsrgnlesisslfgytvsvskakptnsefiamvadklrle
>d1fc3b_ a.4.6.3 (B:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]}
kpknldasitsiiheigvpahikgylylreaiamvyhdiellgsitkvlypdiakkyntt
asrverairhaievawsrgnlkakptnsefiamvadklrle
Timeline for d1fc3b_: