Lineage for d1z3ud1 (1z3u D:281-495)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608754Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2608755Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2608856Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 2608857Protein automated matches [190726] (1 species)
    not a true protein
  7. 2608858Species Human (Homo sapiens) [TaxId:9606] [187887] (49 PDB entries)
  8. 2608938Domain d1z3ud1: 1z3u D:281-495 [162376]
    Other proteins in same PDB: d1z3ua2, d1z3ub2, d1z3uc2, d1z3ud2
    automated match to d1jc9a_
    complexed with ca

Details for d1z3ud1

PDB Entry: 1z3u (more details), 2.25 Å

PDB Description: Structure of the Angiopoietin-2 Recptor Binding Domain and Identification of Surfaces Involved in Tie2 Recognition
PDB Compounds: (D:) Angiopoietin-2

SCOPe Domain Sequences for d1z3ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ud1 d.171.1.0 (D:281-495) automated matches {Human (Homo sapiens) [TaxId: 9606]}
frdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtwk
eykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelnyr
ihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmyy
pqrqntnkangikwaawkgsgyslkattmmirpad

SCOPe Domain Coordinates for d1z3ud1:

Click to download the PDB-style file with coordinates for d1z3ud1.
(The format of our PDB-style files is described here.)

Timeline for d1z3ud1: