Lineage for d1z3ud_ (1z3u D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048777Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 1048778Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 1048879Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 1048880Protein automated matches [190726] (1 species)
    not a true protein
  7. 1048881Species Human (Homo sapiens) [TaxId:9606] [187887] (18 PDB entries)
  8. 1048910Domain d1z3ud_: 1z3u D: [162376]
    automated match to d1jc9a_
    complexed with ca

Details for d1z3ud_

PDB Entry: 1z3u (more details), 2.25 Å

PDB Description: Structure of the Angiopoietin-2 Recptor Binding Domain and Identification of Surfaces Involved in Tie2 Recognition
PDB Compounds: (D:) Angiopoietin-2

SCOPe Domain Sequences for d1z3ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z3ud_ d.171.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfrdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtw
keykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelny
rihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmy
ypqrqntnkangikwaawkgsgyslkattmmirpad

SCOPe Domain Coordinates for d1z3ud_:

Click to download the PDB-style file with coordinates for d1z3ud_.
(The format of our PDB-style files is described here.)

Timeline for d1z3ud_: