SCOPe 2.02: Domain d1z3ua_: 1z3u A:

Lineage for d1z3ua_ (1z3u A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.0: automated matches [191465] (1 protein)
   not a true family

6. Protein automated matches [190726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187887] (22 PDB entries)

8. Domain d1z3ua_: 1z3u A: [162373]
   automated match to d1jc9a_
   complexed with ca

Details for d1z3ua_

PDB Entry: 1z3u, 2.25 Å

PDB Description: structure of the angiopoietin-2 recptor binding domain and identification of surfaces involved in tie2 recognition

PDB Compounds: (A:) Angiopoietin-2

SCOPe Domain Sequences for d1z3ua_:

Sequence; same for both SEQRES and ATOM records:

>d1z3ua_ d.171.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfrdcaevfksghttngiytltfpnsteeikaycdmeaggggwtiiqrredgsvdfqrtw
keykvgfgnpsgeywlgnefvsqltnqqryvlkihlkdwegneayslyehfylsseelny
rihlkgltgtagkissisqpgndfstkdgdndkcickcsqmltggwwfdacgpsnlngmy
ypqrqntnkangikwaawkgsgyslkattmmirpad

Timeline for d1z3ua_:

• d1z3ua_ first appeared in SCOPe 2.01
  
• d1z3ua_ appears in SCOPe 2.03
  
• d1z3ua_ appears in the current release, SCOPe 2.08, called d1z3ua1