![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily) sandwich; 11 strands in 2 sheets |
![]() | Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) ![]() has two smaller insertion domains |
![]() | Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins) automatically mapped to Pfam PF00314 |
![]() | Protein automated matches [190195] (6 species) not a true protein |
![]() | Species Musa acuminata [TaxId:4641] [188166] (1 PDB entry) |
![]() | Domain d1z3qa_: 1z3q A: [162370] automated match to d1du5a_ complexed with edo |
PDB Entry: 1z3q (more details), 1.7 Å
SCOPe Domain Sequences for d1z3qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z3qa_ b.25.1.1 (A:) automated matches {Musa acuminata [TaxId: 4641]} atfeivnrcsytvwaaavpgggrqlnqgqswtinvnagttggriwgrtgcsfdgsgrgrc qtgdcggvlsctaygnppntlaefalnqfnnldffdislvdgfnvpmdfsptsggcrgir caadingqcpgalkapggcnnpctvfktdqyccnsgacsptdysqffkrncpdaysypkd dqtttftcpggtnyrvvfcp
Timeline for d1z3qa_: