Lineage for d1z33a_ (1z33 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 997377Protein automated matches [190142] (12 species)
    not a true protein
  7. 997417Species Trichomonas vaginalis [TaxId:5722] [187838] (9 PDB entries)
  8. 997426Domain d1z33a_: 1z33 A: [162363]
    automated match to d1a69a_

Details for d1z33a_

PDB Entry: 1z33 (more details), 2.7 Å

PDB Description: Crystal structure of Trichomonas vaginalis purine nucleoside phosphorylase
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1z33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z33a_ c.56.2.1 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm
ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf
mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem
esaglfpiadlygaragcictvsdhilhheettaeerqnsfqnmmkialeaaikl

SCOPe Domain Coordinates for d1z33a_:

Click to download the PDB-style file with coordinates for d1z33a_.
(The format of our PDB-style files is described here.)

Timeline for d1z33a_: