Lineage for d1z29a_ (1z29 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109987Protein automated matches [190189] (4 species)
    not a true protein
  7. 2109995Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries)
  8. 2110007Domain d1z29a_: 1z29 A: [162362]
    automated match to d1ls6a_
    complexed with a3p, acy, ca

Details for d1z29a_

PDB Entry: 1z29 (more details), 2.4 Å

PDB Description: Crystal Structures of SULT1A2 and SULT1A1*3: Implications in the bioactivation of N-hydroxy-2-acetylamino fluorine (OH-AAF)
PDB Compounds: (A:) Phenol-sulfating phenol sulfotransferase 2

SCOPe Domain Sequences for d1z29a_:

Sequence, based on SEQRES records: (download)

>d1z29a_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifmrvpflefkvpgipsgmetlkntpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvyphpgtwesflekfmagevsygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvgrslpeetvdlmvehtsfkemkknpmtnyttvrref
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

Sequence, based on observed residues (ATOM records): (download)

>d1z29a_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srppleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggap
ifmrvpflefkvpgipsgmetlkntpaprllkthlplallpqtlldqkvkvvyvarnakd
vavsyyhfyhmakvyphpgtwesflekfmagevsygswyqhvqewwelsrthpvlylfye
dmkenpkreiqkilefvgrslpeetvdlmvehtsfkemkknpmtnyttvrrefmdhsisp
fmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel

SCOPe Domain Coordinates for d1z29a_:

Click to download the PDB-style file with coordinates for d1z29a_.
(The format of our PDB-style files is described here.)

Timeline for d1z29a_: