![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
![]() | Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46902] (5 PDB entries) |
![]() | Domain d1rnla1: 1rnl A:155-216 [16236] Other proteins in same PDB: d1rnla2 complexed with gol, pt |
PDB Entry: 1rnl (more details), 2.4 Å
SCOPe Domain Sequences for d1rnla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rnla1 a.4.6.2 (A:155-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} qltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwvhqer if
Timeline for d1rnla1: