SCOP 1.57: Domain d1rnl_1: 1rnl 155-216

Lineage for d1rnl_1 (1rnl 155-216)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families)

5. Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (2 proteins)

6. Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species)

7. Species Escherichia coli [TaxId:562] [46902] (2 PDB entries)

8. Domain d1rnl_1: 1rnl 155-216 [16236]
   Other proteins in same PDB: d1rnl_2

Details for d1rnl_1

PDB Entry: 1rnl, 2.4 Å

PDB Description: the nitrate/nitrite response regulator protein narl from narl

SCOP Domain Sequences for d1rnl_1:

Sequence; same for both SEQRES and ATOM records:

>d1rnl_1 a.4.6.2 (155-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli}
qltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwvhqer
if

Timeline for d1rnl_1:

• d1rnl_1 first appeared (with stable ids) in SCOP 1.55
  
• d1rnl_1 appears in SCOP 1.59
  
• d1rnl_1 appears in the current release, SCOPe 2.08, called d1rnla1