Lineage for d1rnl_1 (1rnl 155-216)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1689Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) (S)
  5. 1698Family a.4.6.2: Nitrate/nitrite response regulator (NARL) [46900] (1 protein)
  6. 1699Protein Nitrate/nitrite response regulator (NARL) [46901] (1 species)
  7. 1700Species Escherichia coli [TaxId:562] [46902] (2 PDB entries)
  8. 1703Domain d1rnl_1: 1rnl 155-216 [16236]
    Other proteins in same PDB: d1rnl_2

Details for d1rnl_1

PDB Entry: 1rnl (more details), 2.4 Å

PDB Description: the nitrate/nitrite response regulator protein narl from narl

SCOP Domain Sequences for d1rnl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rnl_1 a.4.6.2 (155-216) Nitrate/nitrite response regulator (NARL) {Escherichia coli}
qltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwvhqer
if

SCOP Domain Coordinates for d1rnl_1:

Click to download the PDB-style file with coordinates for d1rnl_1.
(The format of our PDB-style files is described here.)

Timeline for d1rnl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rnl_2