![]() | Class a: All alpha proteins [46456] (138 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) |
![]() | Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) ![]() |
![]() | Family a.4.6.2: Nitrate/nitrite response regulator (NARL) [46900] (1 protein) |
![]() | Protein Nitrate/nitrite response regulator (NARL) [46901] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46902] (2 PDB entries) |
![]() | Domain d1rnl_1: 1rnl 155-216 [16236] Other proteins in same PDB: d1rnl_2 |
PDB Entry: 1rnl (more details), 2.4 Å
SCOP Domain Sequences for d1rnl_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rnl_1 a.4.6.2 (155-216) Nitrate/nitrite response regulator (NARL) {Escherichia coli} qltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavwvhqer if
Timeline for d1rnl_1: