Lineage for d1z1pa_ (1z1p A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. Protein automated matches [190406] (19 species)
    not a true protein
  7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (56 PDB entries)
  8. Domain d1z1pa_: 1z1p A: [162359]
    automated match to d1qyoa_

Details for d1z1pa_

PDB Entry: 1z1p (more details), 2 Å

PDB Description: y66l variant of enhanced green fluorescent protein with 412-nm absorbing chromophore
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1z1pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1pa_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttltlgvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d1z1pa_ are not available.

Timeline for d1z1pa_: