Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species) contains an extra alpha-helical domain |
Species SARS coronavirus [TaxId:227859] [89349] (86 PDB entries) |
Domain d1z1ja_: 1z1j A: [162357] automated match to d1uj1b_ mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 1z1j (more details), 2.8 Å
SCOPe Domain Sequences for d1z1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z1ja_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]} sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng spsgvyqcamrpnhtikgsflngsagsvgfnidydcvsfcymhhmelptgvhagtdlegk fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc sgvtfq
Timeline for d1z1ja_: