Lineage for d1z19b_ (1z19 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605773Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2605774Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2605775Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2605846Protein Integrase (Int) [56353] (2 species)
  7. 2605847Species Bacteriophage lambda [TaxId:10710] [56354] (5 PDB entries)
  8. 2605851Domain d1z19b_: 1z19 B: [162355]
    automated match to d1p7da_
    protein/DNA complex

Details for d1z19b_

PDB Entry: 1z19 (more details), 2.8 Å

PDB Description: Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1z19b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z19b_ d.163.1.1 (B:) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
egkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeylkiyqaae
sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik

SCOPe Domain Coordinates for d1z19b_:

Click to download the PDB-style file with coordinates for d1z19b_.
(The format of our PDB-style files is described here.)

Timeline for d1z19b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z19a_