SCOPe 2.08: Domain d1z19b_: 1z19 B:

Lineage for d1z19b_ (1z19 B:)

1. Root: SCOPe 2.08
2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)
5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
6. Protein Integrase (Int) [56353] (2 species)
7. Species Bacteriophage lambda [TaxId:10710] [56354] (5 PDB entries)
8. Domain d1z19b_: 1z19 B: [162355]
   automated match to d1p7da_
   protein/DNA complex
   has additional subdomain(s) that are not in the common domain

Details for d1z19b_

PDB Entry: 1z19, 2.8 Å

PDB Description: Crystal structure of a lambda integrase(75-356) dimer bound to a COC' core site

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d1z19b_:

Sequence; same for both SEQRES and ATOM records:

>d1z19b_ d.163.1.1 (B:) Integrase (Int) {Bacteriophage lambda [TaxId: 10710]}
mtlhswldryekilasrgikqktlinymskikairrglpdapledittkeiaamlngyid
egkaasaklirstlsdafreaiaeghittnhvaatraakskvrrsrltadeylkiyqaae
sspcwlrlamelavvtgqrvgdlcemkwsdivdgylyveqsktgvkiaiptalhidalgi
smketldkckeilggetiiastrreplssgtvsryfmrarkasglsfegdpptfhelrsl
sarlyekqisdkfaqhllghksdtmasqyrddrgrewdkieik

SCOPe Domain Coordinates for d1z19b_ are not available.

Timeline for d1z19b_:

• d1z19b_ first appeared in SCOPe 2.01
  
• d1z19b_ appears in SCOPe 2.07