SCOPe 2.02: Domain d1z18a_: 1z18 A:

Lineage for d1z18a_ (1z18 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein automated matches [190296] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187775] (5 PDB entries)

8. Domain d1z18a_: 1z18 A: [162353]
   automated match to d2liva_
   complexed with cd, val

Details for d1z18a_

PDB Entry: 1z18, 2.1 Å

PDB Description: Crystal structure analysis of periplasmic Leu/Ile/Val-binding protein with bound valine

PDB Compounds: (A:) Leu/Ile/Val-binding protein

SCOPe Domain Sequences for d1z18a_:

Sequence; same for both SEQRES and ATOM records:

>d1z18a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqivkyddacdpkqava
vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak

Timeline for d1z18a_:

• d1z18a_ first appeared in SCOPe 2.01
  
• d1z18a_ appears in SCOPe 2.03
  
• d1z18a_ appears in the current release, SCOPe 2.08