Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins) |
Protein automated matches [190296] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [187775] (5 PDB entries) |
Domain d1z18a_: 1z18 A: [162353] automated match to d2liva_ complexed with cd, val |
PDB Entry: 1z18 (more details), 2.1 Å
SCOPe Domain Sequences for d1z18a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z18a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqivkyddacdpkqava vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak
Timeline for d1z18a_: