Lineage for d1z18a_ (1z18 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008365Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1008366Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1008367Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1008567Protein automated matches [190296] (4 species)
    not a true protein
  7. 1008568Species Escherichia coli K-12 [TaxId:83333] [187775] (5 PDB entries)
  8. 1008573Domain d1z18a_: 1z18 A: [162353]
    automated match to d2liva_
    complexed with cd, val

Details for d1z18a_

PDB Entry: 1z18 (more details), 2.1 Å

PDB Description: Crystal structure analysis of periplasmic Leu/Ile/Val-binding protein with bound valine
PDB Compounds: (A:) Leu/Ile/Val-binding protein

SCOPe Domain Sequences for d1z18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z18a_ c.93.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqivkyddacdpkqava
vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak

SCOPe Domain Coordinates for d1z18a_:

Click to download the PDB-style file with coordinates for d1z18a_.
(The format of our PDB-style files is described here.)

Timeline for d1z18a_: