Lineage for d1a04b1 (1a04 B:150-216)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1689Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) (S)
  5. 1698Family a.4.6.2: Nitrate/nitrite response regulator (NARL) [46900] (1 protein)
  6. 1699Protein Nitrate/nitrite response regulator (NARL) [46901] (1 species)
  7. 1700Species Escherichia coli [TaxId:562] [46902] (2 PDB entries)
  8. 1702Domain d1a04b1: 1a04 B:150-216 [16235]
    Other proteins in same PDB: d1a04a2, d1a04b2

Details for d1a04b1

PDB Entry: 1a04 (more details), 2.2 Å

PDB Description: the structure of the nitrate/nitrite response regulator protein narl in the monoclinic c2 crystal form

SCOP Domain Sequences for d1a04b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a04b1 a.4.6.2 (B:150-216) Nitrate/nitrite response regulator (NARL) {Escherichia coli}
erdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavw
vhqerif

SCOP Domain Coordinates for d1a04b1:

Click to download the PDB-style file with coordinates for d1a04b1.
(The format of our PDB-style files is described here.)

Timeline for d1a04b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a04b2