SCOPe 2.04: Domain d1yzwc_: 1yzw C:

Lineage for d1yzwc_ (1yzw C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Heteractis crispa [TaxId:175771] [188161] (1 PDB entry)

8. Domain d1yzwc_: 1yzw C: [162346]
   automated match to d1xqma_
   complexed with peg

Details for d1yzwc_

PDB Entry: 1yzw, 2.1 Å

PDB Description: The 2.1A Crystal Structure of the Far-red Fluorescent Protein HcRed: Inherent Conformational Flexibility of the Chromophore

PDB Compounds: (C:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d1yzwc_:

Sequence; same for both SEQRES and ATOM records:

>d1yzwc_ d.22.1.1 (C:) automated matches {Heteractis crispa [TaxId: 175771]}
gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt
nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr
altmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpek

Timeline for d1yzwc_:

• d1yzwc_ first appeared in SCOPe 2.01
  
• d1yzwc_ appears in SCOPe 2.03
  
• d1yzwc_ appears in SCOPe 2.05
  
• d1yzwc_ appears in the current release, SCOPe 2.08