Lineage for d1yzwb_ (1yzw B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1643322Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1643323Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1643324Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1643577Protein automated matches [190406] (14 species)
    not a true protein
  7. 1643734Species Heteractis crispa [TaxId:175771] [188161] (1 PDB entry)
  8. 1643736Domain d1yzwb_: 1yzw B: [162345]
    automated match to d1xqma_
    complexed with peg

Details for d1yzwb_

PDB Entry: 1yzw (more details), 2.1 Å

PDB Description: The 2.1A Crystal Structure of the Far-red Fluorescent Protein HcRed: Inherent Conformational Flexibility of the Chromophore
PDB Compounds: (B:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d1yzwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yzwb_ d.22.1.1 (B:) automated matches {Heteractis crispa [TaxId: 175771]}
gllkesmrikmymegtvnghyfkcegegdgnpfagtqsmrihvtegaplpfafdilapcc
esrtfvhhtaeipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvhgt
nfpadgpvmknksggwepstevvypengvlcgrnvmalkvgdrhlichhytsyrskkavr
altmpgfhftdirlqmlrkkkdeyfelyeasvarysdlpek

SCOPe Domain Coordinates for d1yzwb_:

Click to download the PDB-style file with coordinates for d1yzwb_.
(The format of our PDB-style files is described here.)

Timeline for d1yzwb_: