| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
| Protein automated matches [190475] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187400] (140 PDB entries) |
| Domain d1yz4b_: 1yz4 B: [162340] Other proteins in same PDB: d1yz4a2 automated match to d1m3ga_ complexed with bog, so4 |
PDB Entry: 1yz4 (more details), 2.4 Å
SCOPe Domain Sequences for d1yz4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yz4b_ c.45.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gngmtkvlpglylgnfidakdldqlgrnkithiisihespqpllqditylripvadtpev
pikkhfkecinfihccrlnggnclvhsfagisrsttivtayvmtvtglgwrdvleaikat
rpianpnpgfrqqleefgwassqklrrqleerfges
Timeline for d1yz4b_: