| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins) contains additional, fourth helix in the C-terminal extension |
| Protein Nitrate/nitrite response regulator (NarL) [46901] (1 species) |
| Species Escherichia coli [TaxId:562] [46902] (5 PDB entries) |
| Domain d1a04a1: 1a04 A:150-216 [16234] Other proteins in same PDB: d1a04a2, d1a04b2 |
PDB Entry: 1a04 (more details), 2.2 Å
SCOPe Domain Sequences for d1a04a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]}
erdvnqltprerdilkliaqglpnkmiarrlditestvkvhvkhmlkkmklksrveaavw
vhqerif
Timeline for d1a04a1: