Lineage for d1yyza_ (1yyz A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570739Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2570740Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2570741Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2570774Protein Fructose-1,6-bisphosphatase [56657] (7 species)
  7. 2570809Species Pig (Sus scrofa) [TaxId:9823] [56658] (65 PDB entries)
  8. 2570856Domain d1yyza_: 1yyz A: [162336]
    automated match to d1fsaa_
    complexed with amp, f6p, mg, po4

Details for d1yyza_

PDB Entry: 1yyz (more details), 1.85 Å

PDB Description: r-state amp complex reveals initial steps of the quaternary transition of fructose-1,6-bisphosphatase
PDB Compounds: (A:) fructose-1,6-bisphosphatase

SCOPe Domain Sequences for d1yyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yyza_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
ivtltrfvmeegrkargtgemtqllnslctavkaistavrkagilhlygiagstnvtgdq
vkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidcl
vsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpa
igefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmv
advhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptd
ihqrapiilgspedvtelleiyqkha

SCOPe Domain Coordinates for d1yyza_:

Click to download the PDB-style file with coordinates for d1yyza_.
(The format of our PDB-style files is described here.)

Timeline for d1yyza_: