Lineage for d1qqia_ (1qqi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695233Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 2695234Family a.4.6.1: PhoB-like [46895] (6 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 2695240Protein PhoB [46898] (2 species)
  7. 2695241Species Escherichia coli [TaxId:562] [46899] (4 PDB entries)
  8. 2695248Domain d1qqia_: 1qqi A: [16233]

Details for d1qqia_

PDB Entry: 1qqi (more details)

PDB Description: solution structure of the dna-binding and transactivation domain of phob from escherichia coli
PDB Compounds: (A:) phosphate regulon transcriptional regulatory protein phob

SCOPe Domain Sequences for d1qqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqia_ a.4.6.1 (A:) PhoB {Escherichia coli [TaxId: 562]}
maveeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwg
tnvyvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf

SCOPe Domain Coordinates for d1qqia_:

Click to download the PDB-style file with coordinates for d1qqia_.
(The format of our PDB-style files is described here.)

Timeline for d1qqia_: